SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091HTC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HTC8
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-115
Family Capz alpha-1 subunit 0.000000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091HTC8
Sequence length 273
Comment (tr|A0A091HTC8|A0A091HTC8_CALAN) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:KFO98389.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_10473 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLSNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQ
VLITEHGDLGNGRFLDPRNKLSFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVK
DHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLK
IQVHYYEDGNVQLVSHKDIQDSIQVSSDVQTAKEFIKIIEHAENEYQTAISENYQTMSDT
TFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A091HTC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]