SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HZZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HZZ2
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.07e-70
Family T-box 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091HZZ2
Sequence length 188
Comment (tr|A0A091HZZ2|A0A091HZZ2_CALAN) T-box transcription factor TBX22 {ECO:0000313|EMBL:KFP00755.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_04707 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
LQGSELWRRFHEIGTEMIITKAGRRMFPSVRVKVKGLEPLKQYYIAIDVVPVDSKRYRYV
YHSSQWMVAGNTDHSCITPRLYIHPDSPCSGETWMRQIISFDRVKLTNNEMDDKGHIILQ
SMHKYKPRVHVIAQDSRFDLAQIQSLPAEGVQTFSFQETEFTTVTAYQNQQITKLKIDRN
PFAKGFRD
Download sequence
Identical sequences A0A091HZZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]