SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091IQE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IQE9
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily MIR domain 7.19e-34
Family MIR domain 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091IQE9
Sequence length 130
Comment (tr|A0A091IQE9|A0A091IQE9_CALAN) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KFP01856.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_03497 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
RGTPVRCGQAIRLTHLGTGRNLHSHRFTSPLSGNQEVSAFGEDGEGDYLDDWTVVCSGTY
WAREEEVRFQHTSTEVFLSVTGEQYGRPIHGQKEVHGMATSSQNNYWKVMEGIFMQPSEG
FKAEQYHTEL
Download sequence
Identical sequences A0A091IQE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]