SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091J0C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091J0C7
Domain Number 1 Region: 285-475
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-42
Family Eukaryotic proteases 0.00093
Further Details:      
 
Domain Number 2 Region: 101-183
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000114
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0064
Further Details:      
 
Domain Number 3 Region: 185-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 224-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 23-75
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000028
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091J0C7
Sequence length 477
Comment (tr|A0A091J0C7|A0A091J0C7_CALAN) Complement factor I {ECO:0000313|EMBL:KFP05276.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_05146 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
ECLSNKYTHKSCEKVFCHPWERCVDGKCLCKLPYQCPKNGSAVCSAHGKYFHTYCHLKSY
ECQRPEAKFLHKGKCMPEETFSISVGHGGSNLLGVKPVNQKNDIFVCANEWTMNEANVAC
RHLGFELGAEYYQADYSITESALNSLHCLQITCRGLETSLAECHIEVKSRDRNEGFVSLQ
CHENLRACSEREFQCVNQKCISLNKTCDGINDCGDLSDELCCRECRGNSFHCRSDICIPH
QSVCNKEIDCLTGEDEAGVHCAGKDKGAANDSMDEERKMIKTFLPQLHCGLKNHTLIRRK
RIVGGQTARKGEFPWQVAIKDTGSEGATVYCGGVYIGGCWVLTAAHCVRANRVHLYRVWI
GLLDTIMYNRETETFRLNQVIIHENFNTSTYENDIALLELKGFEKGDCSLIQSSPACVPW
SEYMFKAGDRCKVSGWGLEKGYTKQYILKWGNVNLFQNCSELYPGRFFKKMACAGKH
Download sequence
Identical sequences A0A091J0C7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]