SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091JMH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JMH3
Domain Number 1 Region: 236-435
Classification Level Classification E-value
Superfamily MIR domain 1.83e-69
Family MIR domain 0.00000000475
Further Details:      
 
Domain Number 2 Region: 437-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.83e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000215
Further Details:      
 
Domain Number 3 Region: 1122-1278
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.96e-36
Family IP3 receptor type 1 binding core, domain 2 0.0076
Further Details:      
 
Domain Number 4 Region: 108-219
Classification Level Classification E-value
Superfamily MIR domain 9.29e-20
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1230-1320,1416-1502,1531-1684,1959-2069
Classification Level Classification E-value
Superfamily ARM repeat 0.00000393
Family HspBP1 domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091JMH3
Sequence length 2722
Comment (tr|A0A091JMH3|A0A091JMH3_EGRGA) Inositol 1,4,5-trisphosphate receptor type 1 {ECO:0000313|EMBL:KFP21812.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_04880 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
MTDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVNPDYEEDDLECQSSLDPEQDASRRGLRSAQEKMAYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPA
NADILIETKLVLSRFEFEEVSSGENALEVGEDEEEVWLFWRDSNKEIRSKSIRELAQDAK
EGQKEDRDVLSYYRLTACAVAVVGLGEKTLVLWTKQPLETEDEVSFEVRAKSTKLFVARS
PIISIQLSSCLIRALCICMLSFVFCFCFFVLLFFLFSYDSSGTSKDEIKERFAQTMEFVE
EYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFCDLLRLTKILLAILDCVHIT
TIFPITKMAKGEESKGSNVMRSIHGVGELMTQVVLRGGGFLPMAPLAAAPEGNVKQSEPE
KEDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKHEFDESNAQMSESPTGSSNQEMP
ANVPGALDFEHIEEQAEGIFGGRKENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQ
LLFRHFSQRQEVLQAFKQVCVRVENDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDEA
MDGVQGENEHKKKEEGHSKSQKPESTSSYNYRVVKEILLRLSKLCVQESASVRKSRKQQQ
RLLRNMGAHAVVLELLQIPYEKAEDMRMQEIMKLAHEFLQNFCAGNQQNQALLHKHINLF
LNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKF
IKKCQDMVMAELVNAGEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLMYHIHLVELLA
VCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYT
SNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQ
TRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLF
LKSHNIVQKTAMNWRMTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAEL
SVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMM
TKDRGYGEKCKDVSVSLVLFCFKMKFLPAQQELDQSLPQRQLEDHRRGEALRQVLVNRYY
GNVRPAGRRESLTTFGNGPLSAGGASKAGAGGGSSGSSSMSRGEMSLADVQCHLDKEGAS
NLVIDLIMNATSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMK
VAQQEIKATVTVNTSDLGNKKKDEESDRDVPSRKRVREPMTQITEEVRDQLLEASAATRK
AYNTYRREADPDDHYSAAEGAQSAADKTKDDLEMSAVISIMQPILRFLQLLCENHNRDLQ
NFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQ
GPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKASEYFMQSMLTNNASK
LLLAIMESRHDSENAERILYNMRPKELVEVIKKAYLQGEVEFEDGENGEDLAASPRNVGH
NIYILAHQLARHNKELQNMLKPGGQIEGDEALEFYAKHTAQIEIVRSDRTMEQIVFPVPS
ICEFLTKESKLRIYYTTERDEQGSKINDFFMKSEDLFNEMNWQKKLRAQPFLYWCARNMS
FWSSISFNLAVLMNLLVAFFYPFKGIRGGTLEPHLSGLLWTAMLISLAIVIALPLIASTI
LRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYKAMIMDVEFLYHLLYLLI
CALGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYL
FFKDDFILEVDKLPNETLLPEPGETMTGEFLYSDVCKAGSSENCSSIIPSDQLVAEEMEE
ENKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIV
LNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHY
LCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEK
LESTMKLVTNLSGQLSELKDQV
Download sequence
Identical sequences A0A091JMH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]