SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091JSJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JSJ0
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.58e-115
Family Capz alpha-1 subunit 0.000000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JSJ0
Sequence length 273
Comment (tr|A0A091JSJ0|A0A091JSJ0_COLST) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:KFP28097.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_04586 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQ
VLITEHGDLGNGRFLDPRNKLSFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVK
DHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLK
IQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDT
TFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A087QPJ2 A0A091JSJ0 A0A091UW65 A0A091V660 A0A093EH11 A0A093FLD3 A0A093KZA4 A0A093PKK9 A0A093QZ15
XP_009508117.1.22320 XP_009573476.1.87690 XP_009814915.1.37116 XP_009975362.1.75343 XP_009980406.1.11325 XP_010127152.1.88979 XP_010205165.1.23224 XP_010285270.1.48707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]