SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KCH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KCH6
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.68e-53
Family Crystallins/Ca-binding development proteins 0.0000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091KCH6
Sequence length 173
Comment (tr|A0A091KCH6|A0A091KCH6_COLST) Beta-crystallin A3 {ECO:0000313|EMBL:KFP33818.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_05389 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
FQITVYDQENFQGKRMEFTSACPNIMECGFDNIRSLKVECGAWVGYEHTGFCGQQFILES
NAYHIERLMAFRPVCSANHKESKITIFEKDNFIGRQWEISDDYPSLQAMGWANNEVGSMK
IPCGAWVCYQYPGYRGYQYVLESDHHGGDYKHWREWGSHAQTSQIQSIRRVQQ
Download sequence
Identical sequences A0A091KCH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]