SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KL42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KL42
Domain Number 1 Region: 80-212
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-46
Family Regulator of G-protein signaling, RGS 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091KL42
Sequence length 219
Comment (tr|A0A091KL42|A0A091KL42_9GRUI) Regulator of G-protein signaling 20 {ECO:0000313|EMBL:KFP41319.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_06439 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
PMGSERMEMRKRQMSMTQETPGSAQAQHSTGNRGSNACCFCWCCCCSCSCLTVRNQDEER
ARRTSHELQAEGIPNCEESPAPTLEEVNAWAQSFDKLMLTPAGRNAFREFLRTEFSEENM
LFWMACEELKQESNKSVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPSQHTF
DDAQLQIYTLMHRDSYPRFMNSAIYKDLLRSLSEKSIEA
Download sequence
Identical sequences A0A091KL42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]