SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KT83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KT83
Domain Number 1 Region: 2-274
Classification Level Classification E-value
Superfamily BEACH domain 3.79e-121
Family BEACH domain 0.0000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091KT83
Sequence length 274
Comment (tr|A0A091KT83|A0A091KT83_9GRUI) Neurobeachin-like 1 {ECO:0000313|EMBL:KFP42678.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_10003 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
VLQKWVNREISNFDYLIQLNTMAGRTYNDLAQYPVFPWILQDYTSEELDLNNPAVFRDLS
KPIGVVNEKNAKAVKEKYENFEDPLGIVDKFHYGTHYSNAAGVMHYLIRVEPFTTLHIQL
QSGRFDCADRQFHSIPATWQALMDNPNDVKELIPEFFYFPEFLENQNGFNLGQLQISKEV
VNDVVLPKWAHSPEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYC
TYEGAVDLDALTDEKERKALEGMINNFGQTPCQL
Download sequence
Identical sequences A0A091KT83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]