SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LPP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LPP3
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-50
Family Calponin-homology domain, CH-domain 0.000000537
Further Details:      
 
Domain Number 2 Region: 204-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 3.01e-19
Family EB1 dimerisation domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091LPP3
Sequence length 265
Comment (tr|A0A091LPP3|A0A091LPP3_9GRUI) Microtubule-associated protein RP/EB family member 2 {ECO:0000313|EMBL:KFP44791.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_12502 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
SWGMAVNVYSTSITQETMSRHDIIAWVNDILALNYTKVEQLCSGAAYCQFMDMLFPGCIS
LKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFFDA
NYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSR
PSSAKKAAPSSSASKSDKDLETQVIQLSEQVHSLKLALEGVEKERDFYFGKLREIELLCQ
EHGGENNDLVNRLMEVLYASEEHVS
Download sequence
Identical sequences A0A091LPP3 A0A091VUS4 A0A094L0G6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]