SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MNK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MNK7
Domain Number 1 Region: 79-207
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 7.06e-31
Family V-type ATPase subunit E 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091MNK7
Sequence length 216
Comment (tr|A0A091MNK7|A0A091MNK7_9PASS) V-type proton ATPase subunit E 1 {ECO:0000313|EMBL:KFP76864.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_12050 OC=Acanthisitta.
Sequence
QIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI
QMSNLMNQARLKVLKARDDLIADLLNEAKQRLAKVVKDTARYQTLLDGLVLQGFYQLLEA
RLIVRCRKQDLPMVKAAVQKSIPIYKNAIKRDAEVHIDQDNFLPEDIAGGVEIYNSDGKI
KVSNTLESRLDLVAQQMMPEIRVALFGANANRKFLD
Download sequence
Identical sequences A0A091MNK7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]