SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MP20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MP20
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-25
Family SH2 domain 0.00000756
Further Details:      
 
Domain Number 2 Region: 101-148
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000262
Family SOCS box-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091MP20
Sequence length 149
Comment (tr|A0A091MP20|A0A091MP20_9PASS) Suppressor of cytokine signaling 2 {ECO:0000313|EMBL:KFP77006.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_03486 OC=Acanthisitta.
Sequence
GWYWGNMTVAEAKERLQDAPEGTFLVRDSSHSEYLLTISVKTSAGPTNLRIEYQDGKFRL
DSITCVRSRLKQFNSVVHLIEYYVLMCKDRTETPSNGTVHLYLNKPLYTSAPSLQHRCRI
AINKSTNQIWELPLPTRLKEYLKEYQYQV
Download sequence
Identical sequences A0A091MP20 A0A093S1Q4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]