SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091N2A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091N2A2
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091N2A2
Sequence length 62
Comment (tr|A0A091N2A2|A0A091N2A2_APAVI) Protein ZNF783 {ECO:0000313|EMBL:KFP83072.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_08322 OC=Apaloderma.
Sequence
FQVPVTFDDVSVYFNEQEWARLEHWQKDLYRAVMRGNYETLLSLDYAVSKPDILSRIERD
EE
Download sequence
Identical sequences A0A091N2A2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]