SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091N806 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091N806
Domain Number 1 Region: 2-236
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.23e-83
Family Capz beta-1 subunit 0.00000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091N806
Sequence length 240
Comment (tr|A0A091N806|A0A091N806_9PASS) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KFP85586.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_03537 OC=Acanthisitta.
Sequence
VPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSA
RLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIAN
IGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQS
Download sequence
Identical sequences A0A091N806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]