SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NU47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NU47
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.82e-72
Family T-box 0.00000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091NU47
Sequence length 182
Comment (tr|A0A091NU47|A0A091NU47_HALAL) MAX gene-associated protein {ECO:0000313|EMBL:KFP96075.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_09482 OC=Accipitrinae; Haliaeetus.
Sequence
LDNNSMWNEFYHRNTEMILTKQGRRMFPYCRYWITGLDATQRYILVMDISPVDNHRYKWN
GRWWEPSGKAEPHVLGRVFIHPESPSTGQYWMHQPVSFYKLKLTNNTLDQEGHIILHSMH
RYLPRLHLVPADKATEVIQLNGPDVHTFTFPQTEFFAVTAYQNIQITQLKIDYNPFAKGF
RD
Download sequence
Identical sequences A0A091NU47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]