SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091PHN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PHN6
Domain Number 1 Region: 1-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.06e-114
Family Capz alpha-1 subunit 0.000000000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091PHN6
Sequence length 274
Comment (tr|A0A091PHN6|A0A091PHN6_APAVI) F-actin-capping protein subunit alpha-2 {ECO:0000313|EMBL:KFP91015.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_12418 OC=Apaloderma.
Sequence
KVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIDGYDE
QVLITEHGDLGNGKFLDPKNKISFKFDHLRKEATDPRPHEVENAIESWRNSVETAMKAYV
KEHYPNGVCTVYGKTIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSITQVAGIL
KIQVHYYEDGNVQLVSHKDIQDSLTVSNEAQTAKEFIKIVEAAENEYQTAISENYQTMSD
TTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A091PHN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]