SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091PIT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PIT8
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-49
Family Capz beta-1 subunit 0.000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PIT8
Sequence length 162
Comment (tr|A0A091PIT8|A0A091PIT8_HALAL) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KFQ07847.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_08300 OC=Accipitrinae; Haliaeetus.
Sequence
YFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLT
STVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNE
IYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQS
Download sequence
Identical sequences A0A091PIT8 A0A093IT91
XP_015687031.1.16292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]