SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PMQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PMQ4
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 1.6e-51
Family Bcl-2 inhibitors of programmed cell death 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PMQ4
Sequence length 184
Comment (tr|A0A091PMQ4|A0A091PMQ4_HALAL) BH3-interacting domain death agonist {ECO:0000313|EMBL:KFQ08935.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_02735 OC=Accipitrinae; Haliaeetus.
Sequence
NGSVQMERVLLYTFLEVSSDCKFREQLHSLQSQGIVPFPKGSYGYDDEVELQTDGNRSGH
LQNGELVFDPEVNEEVIRIIAAQLAEIGDQFDKEIKARVVNDLAQHFLNENLSGEEITQR
MSEAVEGLARAIPSDMEQEKAMLVLAMVLTKKIANTMPSLLQRVFSTTVNYISQQLHNYI
VRMV
Download sequence
Identical sequences A0A091PMQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]