SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QUL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QUL6
Domain Number 1 Region: 33-155
Classification Level Classification E-value
Superfamily Stathmin 1.01e-48
Family Stathmin 0.00000959
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091QUL6
Sequence length 155
Comment (tr|A0A091QUL6|A0A091QUL6_9GRUI) Stathmin {ECO:0000256|RuleBase:RU004388} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_04335 OC=Mesitornis.
Sequence
AYKEKMKELSLLSLICSCFHTQPHPNTIYQYGDMEVKQLDKRASGQSFEVILKSPSDLSP
ESPILSSPPKKKDLSLEELQRRLEAAEERRKTQEAQVLKQLAEKREHEREVLHKALEENN
NFSRLAEEKLNYKMELSREIREAHLAALRERLREK
Download sequence
Identical sequences A0A087R8N5 A0A087VJT8 A0A091E512 A0A091G863 A0A091IWL7 A0A091JLM5 A0A091L3J8 A0A091PQS1 A0A091QUL6 A0A091S1A2 A0A091T3I8 A0A091TQB6 A0A091WU85 A0A093E877 A0A093FHJ2 A0A093GRN0 A0A093JCM9 A0A093QUI8 A0A093RH12 A0A099Z2Q7 A0A0A0B1I0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]