SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091QV40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QV40
Domain Number 1 Region: 294-481
Classification Level Classification E-value
Superfamily MIR domain 3.01e-48
Family MIR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091QV40
Sequence length 728
Comment (tr|A0A091QV40|A0A091QV40_9GRUI) Protein O-mannosyl-transferase 1 {ECO:0000313|EMBL:KFQ30451.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_14235 OC=Mesitornis.
Sequence
MLAFLKKPVVVTVEINMNLVALTVMGLISRLWGLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNIPVWSLRLLPALAGALCVPLAY
QILVELQSSHCAALGAALLILIENSLITQSKFMLLESILIFFILLAVLSYLKFYNLQRQR
SFSGSWWFWLLLTGVACSCAVGVKYMGLFTYMLLLTIAGLHFWHMIGDQNFSNVSLMCHF
LARGLALIIIPVAMYLSFFYVHLTLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKASRFIGASLPEWGYRQLEVVGEKLS
KGFHQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNE
DTEHKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVVTWASANVAALVYACLSLWYLI
RRRRQIYDIPEDVWQLWVSAGGICVGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLIPI
VLQHLSNHLCRSLLLKSMFSALIIAWFSSVYAVYRTFSPVTYGDPSLSVTELKDLRWKDS
WNILIRKQ
Download sequence
Identical sequences A0A091QV40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]