SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091S5A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091S5A7
Domain Number 1 Region: 236-435
Classification Level Classification E-value
Superfamily MIR domain 5.76e-69
Family MIR domain 0.00000000501
Further Details:      
 
Domain Number 2 Region: 437-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.83e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000215
Further Details:      
 
Domain Number 3 Region: 1124-1280
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.44e-36
Family IP3 receptor type 1 binding core, domain 2 0.0074
Further Details:      
 
Domain Number 4 Region: 108-219
Classification Level Classification E-value
Superfamily MIR domain 9.42e-20
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1232-1322,1418-1504,1533-1686,1961-2080
Classification Level Classification E-value
Superfamily ARM repeat 0.0000036
Family HspBP1 domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091S5A7
Sequence length 2753
Comment (tr|A0A091S5A7|A0A091S5A7_NESNO) Inositol 1,4,5-trisphosphate receptor type 1 {ECO:0000313|EMBL:KFQ51263.1} KW=Complete proteome; Reference proteome OX=176057 OS=Nestor notabilis (Kea). GN=N333_13397 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Nestor.
Sequence
MTDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVNPDYEEDDLECQSSLDPEQDASRRGLHSAQEKMAYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEEVSSGENALEVGEDEEEVWLFWRDSNKEIRSKSIRELAQDAK
EGQKEDRDVLGYYRLSIRLFAQSKAKPKGKMLKQVMSWRQSHSLTSNGRYSDTVILTNQC
KMVSGEKSPVYLHAKFCVLFCFLFCFVFFLFSYDSSGTSKDEIKERFAQTMEFVEEYLRD
VVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFCDLLRLTKILLAILDCVHITTIFPI
TKMAKGEESKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPLAAAPEGNVKQTEPEKEDIL
VMDTKLKIIEILQFILNVRLDYRISCLLCIFKHEFDESNAQMSESPTGSSTQEMSANVPG
ALDFEHIEEQAEGIFGGRKVSLHYEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
ETMDGVQGENEHKKKEEGHSKSQKPESTSSYNYRVVKEILLRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTRMQEIMKLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNAGEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNLVQKTAMNWRMTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKGINSNYGSNAFLPQPPETESPVEQELDQSLPQRQLEDHRRGEALRQVLV
NRYYGNVRPAGRRESLTTFGNGPLSAGGASKAGAGGGSSGSSSVSRGEMSLADVQCHLDK
EGASNLVIDLIMNATSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFY
DRMKVAQQEIKATVTVNTSDLGNKKKDEDSDRDVPNRKRVREPMSQITEEVRDQLLEASA
ATKKAYNTYRREADPDDHYSAEAQSAADKSKDDLEMSAVISIMQPILRFLQLLCENHNRD
LQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEY
CQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKASEYFNNASKLLLA
IMESRHDSENAERILYNMRPKELVEVIKKAYLQGEVEFEDGENGEDVAASPRNVGHNIYI
LAHQLARHNKELQNMLKPGGQIEGDEALEFYAKHTAQIEIVRSDRTMEQIVFPVPSICEF
LTKESKLRIYYTTERDEQGSKINDFFLKSEDLFNEMNWQKKLRAQPFLYWCARNMSFWSS
ISFNLAVLMNLLVAFFYPFKGIRGGTLEPHLSGLLWTAMLISLAIVIALPKPHGIRALIA
STILRLIFSIGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYKAMIMDVEFLYHLLY
LLICALGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIV
GYLFFKDDFILEVDKLPNETLLPDRTEPGETMTGEFLYSDVCKAGSSENCSSIIPSDQLI
AEEMEEENKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFF
MVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEE
HNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNEL
RNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPPMNVNLQQ
Download sequence
Identical sequences A0A091S5A7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]