SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SLT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SLT9
Domain Number 1 Region: 312-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000418
Family VWC domain 0.0062
Further Details:      
 
Domain Number 2 Region: 178-235
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000136
Family VWC domain 0.012
Further Details:      
 
Domain Number 3 Region: 255-310
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.0068
Further Details:      
 
Domain Number 4 Region: 105-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000659
Family VWC domain 0.0034
Further Details:      
 
Domain Number 5 Region: 34-67
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000122
Family Huristasin-like 0.0025
Further Details:      
 
Domain Number 6 Region: 65-94
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00000185
Family Huristasin-like 0.0069
Further Details:      
 
Domain Number 7 Region: 9-35
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000338
Family Huristasin-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091SLT9
Sequence length 535
Comment (tr|A0A091SLT9|A0A091SLT9_9AVES) Cysteine-rich motor neuron 1 protein {ECO:0000313|EMBL:KFQ59328.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_00971 OC=Pelecanus.
Sequence
EELCTGLISGCSLDCSFGFQTDVHNCEICQCRPRPKKCKPIVCDKYCPFGYLKNKHGCEI
CRCKKCPDLPCGKVCPMGFQQNNHGCVICKCREATASLMPPVKTGSCLSMDGRRHENEES
WHDGCRECYCHNGREMCALITCPVPNCGNPTIHPGQCCPSCPDEIIVQKPELTSPSICHA
PGGEYFVEGETWNIDSCTQCTCHSGRVLCETEVCPPLLCQNPTRTQDSCCPQCPDEPLQP
SSSSNESMPSYCKNDEGDIFLTAESWKPNVCTSCICMDGVIRCYSETCPPVSCERPVLRK
GQCCPYCIEDAVPKKVVCHFNGKTYADEERWDIDSCTHCYCLQGQTLCSTVSCPPLPCAE
PINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGDIELEVPNWPTPSENDIIHIHRDMSHLQ
GEYRSGGGPHPSEDASVSSVALVTIPIMIALLLIIILLLINQKKQWIPVSCYKAPTKPSC
LNNQLVYVDCKKGTMVQVDSSQRMLRIADPDSRYSGFYSMQKQNNLQADNFYQTV
Download sequence
Identical sequences A0A091SLT9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]