SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091SNX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SNX7
Domain Number 1 Region: 182-393
Classification Level Classification E-value
Superfamily MIR domain 8.11e-59
Family MIR domain 0.0000000821
Further Details:      
 
Domain Number 2 Region: 395-560
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.05e-56
Family IP3 receptor type 1 binding core, domain 2 0.000000227
Further Details:      
 
Domain Number 3 Region: 1119-1240
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.59e-33
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 52-165
Classification Level Classification E-value
Superfamily MIR domain 3.14e-21
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091SNX7
Sequence length 1650
Comment (tr|A0A091SNX7|A0A091SNX7_9AVES) Inositol 1,4,5-trisphosphate receptor type 2 {ECO:0000313|EMBL:KFQ60397.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_10088 OC=Pelecanus.
Sequence
DCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEI
VKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIQPFWKLRSEGD
NVVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKFSSYRDDVL
KGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRG
GAGQWNSLFRFKHLATGNYLAAELNPHYPEGSNEGKALRDGDLPASKKKRQAGEKIMYTL
VSVPHGNDIASLFELDATTLQRADCLLRTDPSNLLFVLLSFRNSYVRLRHLCTNTWVTST
SIPIDTDEERPVMLKIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDANKVLASTVKKLEN
GTITQNERRFVTKLLEDLIFFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQIFGI
LKAPFKDKGEGSMLRLEDLGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQ
SQIGYDILAEDTITALLHNNRKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNT
TAIPVTQELICKFMLSPGNADILIQTKLVSTQMDNPLECPAISDDIDEEEVWLYWIDSNK
EPHGKAIRHLAQEAKEGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISAQLSVDLIL
RCMSDESLPYDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSFTDS
SRNEMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSEL
LRLTRTLLAILDIVQVPISSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPIS
APDVQPSIHPSKQASTSDSEDVIVMDTKLKIIEILQFILSVRLDYRISYMLSIYKREFGE
NNENVDSSTTSPPDTPGIASAIVPDIDEIAAQAETMFAGRKEKNAVQLDDEGGRTFLRVL
IHLIMHDYPPLLSGALHLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRL
TVEKSELWVEKSSSYESGEVGDNQTKGGEEPIEESNILSPIQDGTKKPQIDSNKSNNYNI
VKEILIRLSKLCVQNKKCRNQQQRLLKNMGAHLVVLDLLQIPYEKSDEKMNEVMNLAHTF
LQNFCRGNPQNQVLLHKNLNLFLTPGLLEAETMRHIFMNNYLLCNEISERVVQHFVHCIE
THGRHVEYLRFLQTIVKADGKYVKKCQDMVMTELINGGEDVLIFYNDRASFPVLLQMMCS
ERDRADESGPLAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKI
AYVNFVNHCYVDTEVEMKEIYASNHIWKLFENFLVDMARVCNTTTDRKHADTSLEKYVTE
PVMNIVSGFFNSPFSDNSTSLQTHQPVFIQLLQSAFRIYNCTWPNPTQKASVESCIKTLA
EVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRMSARSGPRFKEALGGPAWDYRN
IIEKLQDVVSSLEQQFTPMMQAEFSVLVDVLHSPELLFPEGSDARIRCGAFMSKLINHTK
KLMEKEEKLCIKILQTLREMLDKKTNFAEE
Download sequence
Identical sequences A0A091SNX7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]