SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091STW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091STW9
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.0000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091STW9
Sequence length 136
Comment (tr|A0A091STW9|A0A091STW9_9AVES) Rho GTPase-activating protein 15 {ECO:0000313|EMBL:KFQ62079.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_08048 OC=Pelecanus.
Sequence
EERLSLADPEWSDIHVVTGALKLFFRELPEPLVPYGLFDPFIQATKLPDPQEQVERVAEL
VQSLPPANYATLRYLLAHLCRVMERVDVNHMTRQNIGIVFGPTLLRPEREPGSLAAGMVQ
QNQAVELLLAHFDRIF
Download sequence
Identical sequences A0A091STW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]