SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TF05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TF05
Domain Number 1 Region: 66-162
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-26
Family SH2 domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 192-241
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000000262
Family SOCS box-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091TF05
Sequence length 242
Comment (tr|A0A091TF05|A0A091TF05_PHALP) Cytokine-inducible SH2-containing protein {ECO:0000313|EMBL:KFQ73286.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_12000 OC=Phaethon.
Sequence
PRPLLAEEKIRRLSLRGLAVDLSEPIMQPLPVTAFQEESTPAFAAPVPDSNPPQARDPEE
DLLCIAKTFSYLRESGWYWGSITASEAKQHLQKMPEGTFLVRDSTHPSYLFTLSVKTNRG
PTNVRIEYTDSKFRLDSNYLSKPRILAFPDVVSLIQHYVMSCTMESKNEAPYPPPSPLPP
MQKEMTAAAVHLKLIRPLGRKDNIPSLQHLCRLRINKSTADVDQLPLPRRMGDYLKQYPF
QL
Download sequence
Identical sequences A0A091TF05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]