SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TYM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TYM7
Domain Number 1 Region: 1-240
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-82
Family BEACH domain 0.000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091TYM7
Sequence length 240
Comment (tr|A0A091TYM7|A0A091TYM7_PHALP) Neurobeachin-like 2 {ECO:0000313|EMBL:KFQ82897.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_11120 OC=Phaethon.
Sequence
ETLDLTDPAVFRDLSKPIGVVNERHARDVKEKYESFEDPTGTVDKFHYGTHYSNAAGVMH
YLIRTEPFTTLHIQLAGGHPADGPWGGDIRFDCSDRQFHSVPAAWQARMENPVDVKELIP
EFFYFPEFLENQNGFDLGCLQLSNEKVGDVMLPRWALSREDFIYQHRKALESEYVSAHLH
EWIDLIFGYKQRGPAAVEALNVFYYCTYEGAVDLDAIADETQRKALEGIISNFGQTPCQL
Download sequence
Identical sequences A0A091TYM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]