SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091UFQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UFQ9
Domain Number 1 Region: 236-435
Classification Level Classification E-value
Superfamily MIR domain 9.59e-70
Family MIR domain 0.00000000475
Further Details:      
 
Domain Number 2 Region: 437-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.94e-60
Family IP3 receptor type 1 binding core, domain 2 0.0000000215
Further Details:      
 
Domain Number 3 Region: 1120-1276
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.72e-37
Family IP3 receptor type 1 binding core, domain 2 0.0074
Further Details:      
 
Domain Number 4 Region: 108-219
Classification Level Classification E-value
Superfamily MIR domain 5.23e-20
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091UFQ9
Sequence length 1687
Comment (tr|A0A091UFQ9|A0A091UFQ9_PHALP) Inositol 1,4,5-trisphosphate receptor type 1 {ECO:0000313|EMBL:KFQ73020.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_05706 OC=Phaethon.
Sequence
MTDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVNPDYEEDDLECQSSLDPEQDASRRGLRSAQEKMAYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPA
NADILIETKLVLSRFEFEEVSSGENALEVGEDEEEVWLFWRDTNKEIRSKSIRELAQDAK
EGQKEDRDVLSYYRLKSMYSSWLAKFIKAVWGSLCLFEVRAKSTKLFVMRSPIISMSKFK
LFFFFKYPVCLHAKFCGLFCFGFFSLFSYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQ
RFPFSDKEKNKLTFEVVNLARNLIYFGFYNFCDLLRLTKILLAILDCVHITTIFPITKMA
KGEESKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPLAAAPEGNVKQSEPEKEDILVMDT
KLKIIEILQFILNVRLDYRISCLLCIFKHEFDESNAQMSESPTGSSNQEMPTNVPGALDF
EHIEEQAEGIFGGRKVSLHYEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLF
RHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDETMD
GVQGENEHKKKEEGHSKSQKPESTSSYNYRVVKEILLRLSKLCVQESASVRKSRKQQQRL
LRNMGAHAVVLELLQIPYEKAEDTRMQEIMKLAHEFLQNFCAGNQQNQALLHKHINLFLN
PGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIK
KCQDMVMAELVNAGEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLMYHIHLVELLAVC
TEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSN
HMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTR
QPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLK
SHNIVQKTAMNWRMTARNAARRDSVLTASRDYRNIIERLQDIVSALEDRLRPLVQAELSV
LVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTK
DRGYGEK
Download sequence
Identical sequences A0A091UFQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]