SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VGA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VGA2
Domain Number 1 Region: 107-181
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 1.83e-30
Family RPB5 0.0000881
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 5.23e-30
Family Eukaryotic RPB5 N-terminal domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091VGA2
Sequence length 182
Comment (tr|A0A091VGA2|A0A091VGA2_NIPNI) DNA-directed RNA polymerases I, II, and III subunit RPABC1 {ECO:0000313|EMBL:KFR01463.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_07032 OC=Nipponia.
Sequence
TQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIK
MYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEH
VVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRL
VQ
Download sequence
Identical sequences A0A091VGA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]