SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VHX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VHX0
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000706
Family Transducin (heterotrimeric G protein), gamma chain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091VHX0
Sequence length 42
Comment (tr|A0A091VHX0|A0A091VHX0_OPIHO) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 {ECO:0000313|EMBL:KFR02719.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_01796 OC=Opisthocomus.
Sequence
QVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
Download sequence
Identical sequences A0A087RFH0 A0A091GK45 A0A091H5X4 A0A091I2J7 A0A091IW93 A0A091KN86 A0A091KWK5 A0A091LHB6 A0A091PAZ0 A0A091QEC9 A0A091RCY6 A0A091TGS9 A0A091UPA8 A0A091VHX0 A0A091VT99 A0A093CHV3 A0A093DM17 A0A093FUR0 A0A093GTN4 A0A093HTC5 A0A093IPF2 A0A093J7R6 A0A093P2E5 A0A093SZF5 A0A094L463 A0A094L4X1 A0A0A0ABN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]