SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091VN25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VN25
Domain Number 1 Region: 181-358
Classification Level Classification E-value
Superfamily MIR domain 6.89e-51
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1045-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-17
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 3947-4025
Classification Level Classification E-value
Superfamily EF-hand 0.000000000271
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 4 Region: 623-757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000174
Family SPRY domain 0.058
Further Details:      
 
Domain Number 5 Region: 64-146
Classification Level Classification E-value
Superfamily MIR domain 0.00000549
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 1376-1497
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000115
Family SPRY domain 0.022
Further Details:      
 
Domain Number 7 Region: 386-512
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000127
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 8 Region: 2110-2176
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000902
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091VN25
Sequence length 4904
Comment (tr|A0A091VN25|A0A091VN25_NIPNI) Ryanodine receptor 2 {ECO:0000313|EMBL:KFQ91088.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_00196 OC=Nipponia.
Sequence
NVPPDLSICTFVLEQSLSVRALQEMLANTEEKAEGVKGLILLQHTTISLLFIFQSAQGGG
HRTLLYGHAILLRHSYSGMYLCCLSTSRSSMDKLAFDVGLQEDTTGEACWWTIHPASKQR
SEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEVAQGYLI
GGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSIHARSLWRLETLRVAWSGSHI
RWGQPFRLRHITTGKYLSLLDDKSLLLTDKEKADVKSTAFCFRSSKEKLDIGTRKEVDGM
GAPEIKYGDSICFIQHVDTGLWLTYQSADAKSVRMGSVQRKAIMHHEGHMDDGLTLSRSQ
NEESRTARVIRSTVFLFNRFIRGLDALSKKVKSSTVDLPIESVSLSLQDLIGYFHPPDEH
LEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLNVYSSAAHFADVAGKEAGEAWKSI
LNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNII
KEGHIKSIICLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLV
NHVSSMRPNIFLGISEGSAQYRKWYYELMVDHLEPFVTAESTHLRVGWASTEGYSPYPGG
GAEWGGNGVGDDLYSYGFDGLHLWSGCVARTVNSPNQHLLRTDDVISCCLDLSAPSISFR
INGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCFEAVLPK
EKLKVEHSREYKQDRSYTRDLLGPTISLSQAAFTPVPVDTSQIVLPPHLERIREKLAENI
HELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCH
VGIADEHAEEKVKKMKLPKNYQLLSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWAR
DRIRQGWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQ
DHATRLDVCSGIMEKFRIFRTEKTYAVKAGKWYFEFEAVTAGDMRVGWTRPGCLPDQELG
SDEEAFVFDGFKAQRWHQGNEHFGRSWLAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSE
LAFKDFEVGDGFLPVCSLGPCQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITI
WLSKRLPQFLPVPQNHEHIEVMRIDGTIDSCPCLKVTQKSFGSQNSKTDVMFFRLSMPIE
CAEVFSRSAAGGLPGSGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRTEREKDATKPE
LNNHKDYIQEKPSRLKQRFMLRRTKPDYSSSHSARLTEDVLADDRDDYDYLMQTSTYYYS
VRIFPGQEPANVWVGWITSDFHQYDTSFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVC
AGESMSPGQGRNNNGLEIGCLVDAASGLLTFTANGKELGTYYQVEPSTKLFPAVFAQATS
PNVFQFELGRIKNVMPLSAGLFKSEHKNPVSQCPPRLHVQFLTHVLWSRVPNHFLKVDVS
RISERQGWMIQCLNPLQFMALHIPEENRTIDILELTEQEELLKFHYHTLRLYSAVCALGN
NRVAHAMCSHVDESQLLYAIENKYMPGLLRAGYYDLLIDIHLNTYATARLMMNNEFIVPM
TDETKSITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSISSECFQFSPEFPLEILKA
KTIEMLTEAVQEGSLHVRDPVGGSTEFLFVPLIKLFYTLLIMGIFHNGDLKHILQLIEPR
VFKEAMSQEDEIEFSEKELSSDELKSEEGEEETRGEQVPKEGLLQMKLPEPVKLQMCHLL
QYLCDCQVRHRIEAIVAFSDDFVAKLQENQRFRYNEVMQALNMSAALTARKTKEFRSPPQ
EQINMLLNFKDDKNDCPCPEEIRDQLLDFHEDLMTHCGIELDEDGTLDGNSDLTIRGRLL
YLMEKVTYLKKKQAEKPVDDDAKTSSTLQQLISDTMVRWAQESVIEDPELVRAMFVLLHR
QYDGVGGLVRALPKTYTINSVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIM
NNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQN
QKAMFDHLSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLA
GCGLQSCPLLISKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPEC
FGPALRGEGGNGLLAAMEEAIQISEDPTRDGPSPSNGSSKALEMEEQEDDTIHMGNAIMT
FYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLEDLVGVISIPFHMPTIAKDGT
VVEPDMSAGFCPDHKAAMVLFLDRVYGIEDQDFLLHLLEVGFLPDLRAAASLDTAALSAT
DMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIE
ECLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNF
GAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVNMME
KQSSMDSDGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMEKFANGWTYGETYSES
AKVQPLMKQYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQT
SQISVDTAHGYTPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELEAKGGGNHPL
LVPYDTLTAKEKAKDREKAQDILKFLQINGYVVSRGLKDLELDTPSIEKRFAYSFLQQLI
RYVDEAHQYILEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPL
SSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGL
ECVKMALRAFLDNAAEDLEKTMENLKQGQFTHSRNQPKGVTQIINYTTVALLPVLSSLFE
HIGQHQFGEDLILEDVQVSCYRILASLYALGTSKSIYVERQRSALGECLAAFSGAFPVAF
LETHLNKHNIYSIYNTKNARDRAVLNLPTSVEEVCPNIPSLVKLMEEIVELAESGIRYTQ
MPHIMEVVLPMLCSYMSHWWEHGPENNPDKAEMCCTALTSEHMNTLLGNILKIIYNNLGI
DEGAWMKRLAVFSQPIISKAKPQLLKTHFLPLMDKLKKKAAVVVSDEEHLRAEGRGDMSE
AELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSH
NFKREEQNFVVQNEINNMSFLISDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAAL
KRLLPIGLNICAPGDQELIALAKNRFSMKDTEDEVRDIIRSNLHLQGKLEDPAIRWQMAL
YKDLPNRTEDSSDPEKTVERVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVAC
FRMAPLYNLPRHRAVNLFLQGYDKSWIEMEEHYFEDKLIEDLAKPGEEPPEEDESLKRVD
PLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQ
KLLYQQARLHDRGAAEMVLQTISASKGEMGPMVAATLKLGIAILNGGNSTVQQKMLDYLK
DKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVMQDDEFTCDLFRF
LQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQG
QRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDS
SQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLK
LKDLTSSDAFKEYDPDGKGIISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEE
FVKRFHEPAKDIGFNVAVLLTNLSEHMPHDTRLQTFLELSESVLNYFQPFLGRIEIMGSA
KRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQL
AAQISESDLNERSANKEENEKDKPEEQDPRMGFFSLVTMKSALVALKYNLMTLMKMLSMK
SLKKQMKKVKKMTMKDMVMALFYSYWSILMGLLHFACSVVRGFFRIICSLLLGGSLVEGA
KKIKVAELLANMPDPTQDEVRGEGEEGERKPTEAALPTEDLTDLRTLSDESDLLSDIFGL
DLKREGGQYKLIPHNPNAGLSDLLSTPSLAPMPEVQEKIQVKEDEKEEKEETKSEPEKAE
GEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVQESAFWKKIIAYQQKLLNYFARNFYNMR
MLALFVAFAINFILLFYKVSTSAVTEEKEVPAVSAGESTKLNSLESDNQRVIAVHYVLEE
SSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSE
DDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAR
EKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHL
LDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDMPD
MKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQ
GLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLM
YLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences A0A091VN25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]