SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091W0D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091W0D9
Domain Number 1 Region: 27-68
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000126
Family Fibronectin type I module 0.047
Further Details:      
 
Domain Number 2 Region: 2-29
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000213
Family ATI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091W0D9
Sequence length 334
Comment (tr|A0A091W0D9|A0A091W0D9_NIPNI) Uncharacterized protein {ECO:0000313|EMBL:KFR08243.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_06697 OC=Nipponia.
Sequence
THCVSGCVCPHNQVLDGKGGCIAPEDCPCVHNGNSYSPGESIRVGCNNCTCRNRKWHCSE
EPCLETCSVYGDGHYTTFDGKRFDFEGDCEYVLIQNYCGQQGMNQGTFRVITENIPCGTT
GTTCSKSIKVFLGVSIFLNKFDGHSDVIQRTPGGKMPFQIRSMGIYLVVDTTVGLILMWD
KKTSIFIKLSPSFQGHVCGLCGNYDGNGNNDFTTRSQSVVGNVLEFANSWKVSSSCPNAN
RTKDPCTANPYRKAWAQKQCSIITSEVFAKCHSQVEPNEYYQACVDDACACDTGGDCECF
CTAVAAYAQACNELDVCISWRTPSICPLFCDYYN
Download sequence
Identical sequences A0A091W0D9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]