SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091W8H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091W8H0
Domain Number 1 Region: 143-241
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-20
Family I set domains 0.0092
Further Details:      
 
Domain Number 2 Region: 29-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 3 Region: 95-142
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000222
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091W8H0
Sequence length 242
Comment (tr|A0A091W8H0|A0A091W8H0_OPIHO) Kazal-type serine protease inhibitor domain-containing protein 1 {ECO:0000313|EMBL:KFQ98080.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_14570 OC=Opisthocomus.
Sequence
ALLQLGQAFPSTSDYLQRGWQRLLEEGESCAECRPEECPAPRGCLAGTVLDACDCCWECA
NLEGDNPNHFYGKCGEHLECRLDAGDLQHGEVPEPQCACLSHLALCGSDGKTYAQICRFL
EVARAHPDANLTVAHEGPCESEPQITSPPYDTWNITGQDVIFGCEVFAYPMASIEWRKDG
MEMLLPGDDPHISVQFRGGPQKYEVTGWLQIQGVRVTDEGTYRCFARNRVGEVVALASLT
VF
Download sequence
Identical sequences A0A091W8H0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]