SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BJB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BJB1
Domain Number 1 Region: 3-41
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000000339
Family Virus ectodomain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093BJB1
Sequence length 60
Comment (tr|A0A093BJB1|A0A093BJB1_CHAPE) Uncharacterized protein {ECO:0000313|EMBL:KFU91245.1} KW=Complete proteome; Reference proteome OX=8897 OS=Chaetura pelagica (Chimney swift). GN=M959_12906 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Apodidae; Chaetura.
Sequence
AVIDLLLLAHGHGCQESEGMCCMNLSDHSESVHRKIEQLKNGLHNLRENSWGLDAWLGSL
Download sequence
Identical sequences A0A093BJB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]