SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093CFA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093CFA2
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily MIR domain 6.93e-47
Family MIR domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093CFA2
Sequence length 159
Comment (tr|A0A093CFA2|A0A093CFA2_9AVES) Stromal cell-derived factor 2-like 1 {ECO:0000313|EMBL:KFV13103.1} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_10380 OC=Pterocles.
Sequence
TGSGQQSVTGVEASDDANSYWRIRGKSDGSCQRGTPVKCGQAIRLTHVNTGKNLHTHHFP
SPLSNNQEVSAFGDDGEGDDLDIWIVQCSGTYWEREDAVRFKHVGTEVFLSITGEQYGHP
IRGQREVHGMPTANHHNYWKAMEGVFVKPSVDPAKHDEL
Download sequence
Identical sequences A0A093CFA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]