SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093D6H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093D6H4
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily MIR domain 2.44e-41
Family MIR domain 0.0045
Further Details:      
 
Domain Number 2 Region: 837-962
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-17
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 3740-3818
Classification Level Classification E-value
Superfamily EF-hand 0.000000000271
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 4 Region: 415-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000633
Family SPRY domain 0.053
Further Details:      
 
Domain Number 5 Region: 176-304
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000523
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 6 Region: 1166-1287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000111
Family SPRY domain 0.022
Further Details:      
 
Domain Number 7 Region: 1900-1966
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000863
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093D6H4
Sequence length 4697
Comment (tr|A0A093D6H4|A0A093D6H4_TAUER) Ryanodine receptor 2 {ECO:0000313|EMBL:KFV20152.1} KW=Complete proteome; Reference proteome OX=121530 OS=Tauraco erythrolophus (Red-crested turaco). GN=N340_04650 OC=Tauraco.
Sequence
RTVHYEGGAVSIHARSLWRLETLRVAWSGSHIRWGQPFRLRHITTGKYLSLLDDKSLLLT
DKEKADVKSTAFCFRSSKEKLDIGTRKEVDGMGAPEIKYGDSICFIQHVDTGLWLTYQSA
DAKSVRMGSVQRKAIMHHEGHMDDGLTLSRSQNEESRTARVIRSTVFLFNRFIRGLDALS
KKAKSSTIDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINL
VLECIDRLNVYSSAAHFADVAGKEAGEAWKSILNSLYELLAALIRGNRKNCAQFSGSLDW
LISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIIFLLDKHGRNHKVLDVLCSL
CVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGISEGSAQYRKWYYEL
MVDHLEPFVTAESTHLRVGWASTEGYSPYPGGGAEWGGNGVGDDLYSYGFDGLRLWSGCV
ARTVNSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAG
IKVRFLLGGRHGEFKFLPPPGYAPCFEAVLPKEKLKVEHSREYKQDRSYTRDLLGPTISL
SQAAFTPVPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPC
LVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLLSGYK
PAPMDLSLIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYAL
LDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAMKLDVCSGIMEKFRIFRTEKTYAVK
AGKWYFEFEAITAGDMRVGWTRPGCLPDQELGSDEEAFVFDGFKAQRWHQGNEHFGRSWL
AGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFEVGDGFLPVCSLGPSQVGRMNF
GKDVSTLKYFTICGLQEGYEPFAVNTNRDITIWLSKRLPQFLPVPQNHEHIEVMRIDGTI
DSCPCLKVTQKSFGSQNSKTDVMFFRLSMPIECAEVFSRSASGGLPGSGLFGSKNDLEDY
DADSDFEVLMKTAHGHLVPDRTEKDATKPELNNHKDYVQEKPSRLKQRFMLRRTKPDYST
SHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTSFDL
DRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCLVDAASGLLT
FTANGKELGTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPI
SQCPPRLHVQFLTHVLWSRVPNHFLKVDVSRISERQGWMIQCLNPLQFMALHIPEENRTI
DILELTEQEELLKFHYHTLRLYSAVCALGNNRVAHAMCSHVDESQLLYAIENKYMPGLLR
AGYYDLLIDIHLNTYATARLMMNNEFIVPMTDETKSITLFPDENKKHGLPGIGLSTSLRP
RMQFSSPSFVSISSECFQFSPEFPLEILKAKTIEMLTEAVQEGSLHVRDPVGGSTEFLFV
PLIKLFYTLLIMGIFHNGDLKHILQLIEPRVFKEAVSQEDEIDFSEKELSSDELKSEEGE
EETREEQVPKEGLLQMKLPEPVKLQMCHLLQYLCDCQVRHRIEAIVAFSDDFVAKLQENQ
RFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKNDCPCPEEIRDQLLDFH
EDLMTHCGIELDEDGTLDGNSDLTIRGRLLYLMEKVTYLKKKQAEKPVDDDAKTSSTLQQ
LISDTMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINSVSVEDTINLL
ASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLG
GGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPSMRGSTPL
DVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCPLLICKGYPDIGWNPVEGERYLD
FLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIQISEDPTRD
GPSPSNGSSKTFEMEEQEDDTIHMGNAIMTFYSALIDLLGRCAPEMHLIHAGKGEAIRIR
SILRSLIPLEDLVGVISIPFHMPTIAKDGTVVEPDMSAGFCPDHKAAMVLFLDRVYGIED
QDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEH
HASLIDSLLHTVYRLSKGCSLTKAQRDSIEECLLSICGQLRPSMMQHLLRRLVFDVPLLN
EHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQE
LFKLALPCLSAVAGALPPDYMESNYVNMMEKQSSMDSDGNFNPQPVDTSNITIPEKLEYF
INKYAEHSHDKWSMEKFANGWTYGETYSESAKVQPLMKQYKLLSEKEKEIYRWPIKESLK
TMLAWGWRIERTREGDSMALYNRTRRISQTSQISVDTAHGYAPRAIDMSNVTLSRDLHAM
AEMMAENYHNIWAKKKKMELEAKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQING
YVVSRGLKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRGKGEHFPYEQEI
KFFAKVVLPLIDQYFKNHRLYFLSAASRPLSSGGHASNKEKEMVTSLFCKLGVLVRHRIS
LFGNDATSIVNCLHILGQTLDARTVMKTGLETVKMALRAFLDNAAEDLEKTMENLKQGQF
THSRNQPKGVTQIINYTTVALLPVLSSLFEHIGQHQFGEDLILEDVQVSCYRILASLYAL
GTSKSIYVERQRSALGECLAAFSGAFPVAFLETHLNKHNIYSIYNTKNARDRAVLNLPTS
VEEVCPNIPSLVKLMEEIVELAESGIRYTQMPHIMEVILPMLCSYMSHWWEHGPENNPDK
AEMCCTALTSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIISKAKPQLLKTHFL
PLMDKLKKKAAVVVSDEEHLRAEGRGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYN
RAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLISDTKSKMS
KAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSMKD
TDDEVRDIIRSNLHLQGKLEDPAIRWQMALYKDLPNRTEDSSDPEKTVERVLDIANVLFH
LEQVRPVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYDKSWI
ETEEHYFEDKLIEDLAKPGEEPPEEDESLKRVDPLHQLILLFSRTALTEKCKLEEDFLYM
AYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKG
EMGPMVAATLKLGIAILNGGNSTVQQKMLDYLKDKKDVGFFQSLAGLMQSCSVLDLNAFE
RQNKAEGLGMVTEEGSGEKVMQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVN
IIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCT
GNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGN
VVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDAFKEYDPDGKGIISKRDFH
KAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHM
PHDTRLQTFLELSESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESK
RQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEENEKDKPEEQ
DPRMGFFSLVTMKSALVALKYNLMTLMKMLSMKSLKKQMKKVKKMTMKDMVMALFSSYWS
ILMGLLHFACSVIRGFFRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGEGEEG
ERKPTEAVLPTEDLTDLRTLSDESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLLSTP
SLAPMPEVQEKIQVKEDEKEEKEESKSEPEKAEGEDGEKEEKAKEDKGKQKLRQVHTHRY
GEPEVQESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSAVTEE
KEVPVVSAGESTKLNILESDNERVIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGY
YCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVK
RKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKL
GVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLT
VGLLAVVVYLYTVVAFNFFRKFYNKSEDGDMPDMKCDDMLTCYMFHMYVGVRAGGGIGDE
IEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFI
CGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWE
FFPAGDCFRKQYEDQLN
Download sequence
Identical sequences A0A093D6H4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]