SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093DM33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093DM33
Domain Number 1 Region: 22-141
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 4.97e-44
Family Transducin (alpha subunit), insertion domain 0.000000442
Further Details:      
 
Domain Number 2 Region: 1-18,134-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.06e-23
Family G proteins 0.0000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093DM33
Sequence length 200
Comment (tr|A0A093DM33|A0A093DM33_CHAPE) Guanine nucleotide-binding protein G(Q) subunit alpha {ECO:0000313|EMBL:KFU95643.1} KW=Complete proteome; Reference proteome OX=8897 OS=Chaetura pelagica (Chimney swift). GN=M959_01046 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Apodidae; Chaetura.
Sequence
GTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEH
NKAHAQLVREVDVEKVSTFENPYVDAIRSLWNDPGIQECYDRRREYQLSDSTKYYLNDLD
RIADSAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTS
IMFLVALSEYDQVLVESDNE
Download sequence
Identical sequences A0A093DM33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]