SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093E9Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093E9Y2
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily Stathmin 8.89e-48
Family Stathmin 0.00000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093E9Y2
Sequence length 146
Comment (tr|A0A093E9Y2|A0A093E9Y2_9AVES) Stathmin {ECO:0000256|RuleBase:RU004388} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_12015 OC=Pterocles.
Sequence
MATSDIQLKEPEKHASGQAFELILSPCSKEAVPEFPLSPPKKKNVSLEEIQKKLEAAEER
HKSHEAEVWKQLAEKREHEKEVLQKAIEENNFSKMAKEKLTHKMEANNENCEAQMVAKLE
RLREEDKHIEEVPKNKGKDPSEAEPD
Download sequence
Identical sequences A0A093E9Y2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]