SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093F0L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093F0L4
Domain Number 1 Region: 164-344
Classification Level Classification E-value
Superfamily MIR domain 1.83e-46
Family MIR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1023-1114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-17
Family SPRY domain 0.045
Further Details:      
 
Domain Number 3 Region: 603-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000791
Family SPRY domain 0.043
Further Details:      
 
Domain Number 4 Region: 378-492
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000209
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 5 Region: 2006-2070
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000068
Family IP3 receptor type 1 binding core, domain 2 0.021
Further Details:      
 
Domain Number 6 Region: 1283-1395
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000158
Family SPRY domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093F0L4
Sequence length 3462
Comment (tr|A0A093F0L4|A0A093F0L4_TYTAL) Ryanodine receptor 3 {ECO:0000313|EMBL:KFV47679.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_05808 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
QYVPPDLCICNFVLEQSLSVRALQEMLANTGDNATEGAAQGGGHRTLLYGHAILLRHSFS
EMYLTCLTSSRSQTDKLAFDVGLRENAAGEACWWTIHPASKQRSEGEKVRIGDDLILVSV
SSERYLHLSISNGSIQVDASFMQTLWNVHPTCSGSSITEGYLLGGHVVRFFHGHDECLTI
PSTDQNDSQHKKVLYETGGAGVRARSLWRVEPLRISWSGSNIRWGQPFRLRHITTGKYLA
LNEDEGLAMLDREKSDTTSTAFCFRVSKELKEKQDSSLKRDMDGMGVPEIKYGDSICFVQ
HVASALWLTYKAQDAKSARLGPLKRKVILHQEGHMDDGLTLQRCQHEESQAARIIRNTTS
LFSHFISVNNRTLSPTALPIEEMAQTLQDLITYFQLPEEDLEHEDKQSKLRSLKNRQNLF
KEEGMLALVLNCIDRLNDYNSAAHFAGIAREDHGTAWKEILNLLYKLLAALIRGNRNNCT
QFSSNLDWLISKLDRVESSSGILEVLHCILIESPEALNIIAEEHIKSIISLLDKHGRNYK
VLDVLCSLCVCNGVAVRANQNLICDNLLPRRDLLLQTRLINDVTSIRPNIFLGVAEGSAQ
YKKWYFELIIDHVDPFLTAEPTHLRVGWASTSGYAPYPGGGEGWGGNGVGDDLYSYGFDG
LHLWSGRVPRAVASVNQHLLASDDVVSCCLDLGVPSISFRINGQPVQGMFENFSTEGFFF
PVVSLSAGVKVRFLLGGRHGEFKFLPPSGYAPCYEALLPKEKMKLEPVKEYKRDSDGVRD
LLGTTQFLSQASFIPCPIDTSQIALPFHLEKIRDKLAENIHELWGMNKIELGWTYGKIRD
DNKRHHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIVHAHPAAEEDLKKVKLPKN
YMMSNGYKPAPLDLSEVKLLPSQEFLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRN
PRLVPYALLDERTKKSNRDSLREAVRTFAGYGYSIEPPDQEIADQTVEKVSIDKIRFFRV
EQSYAVKSGKWYFEFEAVTGGDMRVGWARPACRPAIELGADDQAFVFEGSKGQRWHQGSG
FFGRSWQPGDVVGCMINLDDKSIIFTLNGELLITSKGSELAFADFGIETGFVPICALGLS
QIGRMNLGMDASTFKYYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKNHPHIEI
WRIDGTIESPPRLKVTHKTFGTQNSNSDMIYCRLSMPIEFRSSFNFSVGVENTSSDVFQK
RKHSQEIAPPYTTCFYSLRIFAGQDPSSVWVGWVTPDYHFYSENFDLNKNCTVTVTLGDE
RGRVHESVKRSNCYMVWGGDVIANSQRSGRSNVDLEIGCFVDLATGMLSFTANGKELGTC
YQVEPNTKLFPATFVQPTSTNLVQFELGKLKNTMPLSAAIFKSEERNPVPQCPPRLDVQT
ITPVLWSRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDL
MKFHYHTLKLYSSVSALGNTRVAYALCSHVDISQLFYTIDNQYLPGLLRSGFYDLLISIH
LEHAKQAKLMMNNEFIIPVTDETRTIKLYPDETKKHGLPGVGLSTCLKPGFNFSTPCFIV
TSEERQTSSPEIPLDTLKSKAISMLTEAVQCSGAHIRDPVGGQVAFQFVPVLKLIATLLV
MGIFDDDDVKQVLLLIDPNVFGDHKEETEERTEKEEVTQVEEKAVEAGEKAIKVTKAPAK
GLLQTRLPESVKLQMCHLLNYFCDCELQHRVEAIVSFADRYVSKLQYNQKYRYNELMQAL
NMSAALTAKKTKEFRSPPQEQINMLLNFQLGEDCPCPEEIRDELYEFHDDLLIHCGIPLE
EEEEEEEDSSLTGKLRSLMYKIKGPPKAEKVEPKEEEDKSPTTLKELISQTMVRWSQEDQ
IQDPELVRIMYTLLRRQYDSIGELLQALRKAYTISAASVKDTINLLAALGQIRSLLSVRM
GKEEELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVMDVMVNVLGGDRSQIVFPKMVAS
CCRFLCYFCRISRQNQKAMFEHLSYLLENSSVGLAFPSMRGSTPLDVAAASVMDNNELAL
ALEEPDLDKVVTYLAGCGLQSCPVLLAKGYPDIGWNPIEGERYLSFLRFAVFVNSESVEE
NASVVVKLLIRRPECFGPDLRGEGGNGLLAAMQEAIRISENPTRDLPSQSYKREGDDEEE
EEEEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQSGKGEAIRIRSILRSLVPTEDLVGI
ISIPLKLSTVNKDGTVNEPDMSANFCPDHKAPMVLFLDRVYGIKDQSFLLHLLEVGFLPD
LRASASLDTVSLSTTEAALALNRYICSAVFPLLKRCAPLFSGTEHHASLVDSMLHTIYRL
SKGRSLTKAQRDTIEECLLAICHHLRPSMLQQLLRRLVFDVPLLNEYCKMPLKLLTNHYE
QCWKYYCLPSGMGSYGIAAEEELHLTEKLFWGIFDSLSHKKYDPELFRMALPCLSAIAGA
LPPDYLDTRIRSTLEKQTSVDPEGNFDPKPVSTANLVLPEKLEYIVSKYAEHSHDKWAFD
KTNSGWKYGVSLDENMKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAMGWSLERTKEG
GEAIIHQRENEKLRSISQSSQGNGYIPAPLDLSNVVLSRELQGMVEVMAENYHNIWAKKK
KMELESKGGGSHPLLVPYDTLTAKEKSRDREKAQELFKFLQVNGIIISRGLNDMELDASS
MEKRFAFKFLKKILKYVDSAQEFIAHLEAIVTSGKTEKSPHDQEIKFFAKVLLPLVDQYF
TNHCLYFLSSPTKTLSSSGYASNKEKEMVASLFCKLAALVRHRISLFGSDSATMVNCLHI
LAQSLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNIN
YTTVALLPILTSIFEHISQHQFGIDLLLGDVQVSCYRILCSLYSLGTGKNIYVERQRPAL
GECLASLAAAIPVAFLEPSLNHYNPLSVFNTKSARERAILGMPDTVEEMCPEIPQLDGLI
KEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGSESVPPTAGPCCTMITSEHLSI
ILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLKTHFIPTLEKLKKKAIKIVM
EEEQLRADSKTDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRANWLKKPDTDSDEL
FRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDTKSKMSKSGGQDQERKKSKRR
GDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKTRYSHRDTDDEVKEHLRNNLHL
QEKSDDPAVKWQLNLYKDILKSDEPTDPERNVERVQRISAALYHLEQVEQPLRSKKAVWH
KLLSKQRKRAVVACFRMAPLYNLPRHKISNFFLSTFQRVWLE
Download sequence
Identical sequences A0A093F0L4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]