SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FXG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FXG5
Domain Number 1 Region: 75-98
Classification Level Classification E-value
Superfamily WW domain 0.000024
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093FXG5
Sequence length 133
Comment (tr|A0A093FXG5|A0A093FXG5_TYTAL) Centrosomal protein of 164 kDa {ECO:0000313|EMBL:KFV59054.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_07362 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
MAGAMVRIGDQLILEEGYDETYVPSEQEIRDFAREIGIDPEKEPELLWLAWGVWYGQLYW
CVLCHLVMLLLPCSQDITGDIYYFNFANGQSTWDHPCDDHYRELVVQEREKLMASGSLKK
KEKKKKKEKKEKK
Download sequence
Identical sequences A0A093FXG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]