SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093G2M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093G2M3
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily MIR domain 2.88e-47
Family MIR domain 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093G2M3
Sequence length 161
Comment (tr|A0A093G2M3|A0A093G2M3_DRYPU) Stromal cell-derived factor 2-like 1 {ECO:0000313|EMBL:KFV63318.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_14104 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
FQTGSGQQSVTGVEASDDANSYWRIRGKSDGSCQRGTPVKCGQAIRLTHVNTGKNLHTHH
FPSPLSNNQEVSAFGDDGEGDDLDIWIVQCSGTYWEREDAVRFKHVGTEVFLSITGEQYG
HPIRGQREVHGMPTANHHNYWKAMEGVFIKPSMDPAKHDEL
Download sequence
Identical sequences A0A093G2M3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]