SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093G8C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093G8C8
Domain Number 1 Region: 146-225
Classification Level Classification E-value
Superfamily TIMP-like 0.0000294
Family Tissue inhibitor of metalloproteinases, TIMP 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093G8C8
Sequence length 259
Comment (tr|A0A093G8C8|A0A093G8C8_DRYPU) Meteorin-like {ECO:0000313|EMBL:KFV65383.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_13091 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
LSFPSGLTHESHKKDVEQVYLRCSEGSIEWMYPTGALIVNLRPNTSPASYKHLTVCIKPF
KDSAGANIYLEKTGELKLLVRDGDCSPSKVYCFGYDQGGLFIEATPQQDISRKITGFQYE
LMSKGMASDLHTVSAPCRPCSDTEVLLAVCTSDFVIRGSIQSVTNQAEEQESIIHVGVNK
LYRQKSKVFQLTGESGNWQGQIKTPLECGVKPGDGDFLFTGRMHFGEARLGCAPRFKDFQ
RMYKEAKDKGLNPCEIGPD
Download sequence
Identical sequences A0A093G8C8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]