SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GFU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GFU4
Domain Number 1 Region: 27-68
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000586
Family Fibronectin type I module 0.07
Further Details:      
 
Domain Number 2 Region: 2-29
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000327
Family ATI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093GFU4
Sequence length 334
Comment (tr|A0A093GFU4|A0A093GFU4_DRYPU) Uncharacterized protein {ECO:0000313|EMBL:KFV68073.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_09266 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
THCVSGCVCPHNKVLDGKGGCIAPEDCPCVHNGNFYNPGESIRVGCNNCTCRNRKWHCSQ
EPCLETCSVYGDGHYTTFDGKRFDFEGDCEYVLVQNYCGQQGTNQGTFRVITENIPCGTT
GTTCSKSIKVFLGVSICFNKCDGQSEVIQRAPGGKMPFQIRSMGIYLVVDTTVGLILMWD
KKTSIFIKLSPSFEGHVCGLCGNYDGNGNNDFTTRSQSVVGNVLEFANSWKVSSSCPSAN
GTKDPCSANPYRKAWAQKQCSIITSEVFAKCHSQVEPNEYYQACVDDACACDTGGDCECF
CTAVAAYAQACNELDICISWRTPSICPLFCDYYN
Download sequence
Identical sequences A0A093GFU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]