SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093HD50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HD50
Domain Number 1 Region: 235-431
Classification Level Classification E-value
Superfamily MIR domain 5.49e-60
Family MIR domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 433-599
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.75e-54
Family IP3 receptor type 1 binding core, domain 2 0.000000355
Further Details:      
 
Domain Number 3 Region: 1117-1267
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-34
Family IP3 receptor type 1 binding core, domain 2 0.0083
Further Details:      
 
Domain Number 4 Region: 107-217
Classification Level Classification E-value
Superfamily MIR domain 2.88e-19
Family MIR domain 0.011
Further Details:      
 
Domain Number 5 Region: 1405-1672,1959-2091
Classification Level Classification E-value
Superfamily ARM repeat 0.0000141
Family MIF4G domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093HD50
Sequence length 2724
Comment (tr|A0A093HD50|A0A093HD50_STRCA) Inositol 1,4,5-trisphosphate receptor type 3 {ECO:0000313|EMBL:KFV79641.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_11477 OC=Struthio.
Sequence
NEMSSFLHVGDIVSLYAEGSVNGFISTLGNLRDLSLVPGVSMQANGVGKATDCLFKVCPM
NRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNETENKKVHGDVVKYGSVI
QLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDK
VILNPVNAGQPLHASNYELADNAGCKEVNSVNCNTSWKINLFMQFCDHLEEVLKGGDVVR
LFHAEQEKFLTCDEYKGKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHWNG
LYRFKHLATGNYLAAEVRGEQRAQTPAATAPRKGSVRPPLEQRWEKIKYRLVAVPHGNDI
ASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLMLGTCPTK
EDKEAFAIVSVPVSEIRDLDFANDASSMLANVVEKMNEGFLSQNDRRFVIQLLEDLVFFV
SDVPNNGQNVLDIVVTKPNRERQKLMREQNILKQIFGILKAPFKDKGGEGPLVRLEELSD
QKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNR
KLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSD
ILIKTELRPVKEMSQTHEYLSIEYSEEEVWLTWTDKNNDHHEKSIRQLAQEARAGNAHDE
NVLSYYRVRLSRSRGLTPSPLNRYQLKLFARMCLDRQYLAIKEISQQLGVDLIFLCMADE
MLPFDLRASFCHLMLHVHVDRDPQELVMPVNYDSNLNVSRDDKKNKFASTMEFVEDYLNN
VVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQNPQLMMQ
AVYSDEVTGKNVRRSIQGVGQIMSTMVLSRKQSIFSAPSLSTGSTPEPVDRGRSIENENI
VVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVYPMQDSAADGTAPAFDSTTAA
MNLDRIGEHAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYPPLISGSLQLLFKHF
SQRQEVLHTFKQVQLLISAQDVENYKVIKSELDKLRTMVEKSELWVDKKGSTKGDSTVEG
NKKEKKEHTADEEVIAPGEKSSENYQIVKGILERLNKMCGVGEQVRKKQQRLLKNMDAHK
VMLDLLQIPYEKGDAKMMEILKFTHQFLQKFCAGNQENQALLHKHLNLFLTPGLLEAETM
QHIFLNNYQLCSEINETVPQHFIHCVATHGRHVQYLDFLHTIIKAEGKYVKKCQDMIMTE
LTNAGDDVVVFYNDKASLATLLEMMTAARDGVEENSPLMYHISLVDLLAACAEGKNVYTE
IKCTSLLPLEDVVRVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENF
TLDMARMCKKREKRLPDPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQLLQS
TMRLLECPWLQQQHKSSVEACIRTLAMVAKSRSIALPMDLDAHVSSLLNSSSTSTVQRNT
SSYKTATRTFPRVSTTPNQWDYKNIIEKLQDIINALEDRLKPLVEAELSVLVDVLHRPEL
LFMEGTEAYQRCESGGFLSKLVQHTKDLMETEEKLCIKVLRTLQQMLVKRNKYGERVSIT
ALQHIPSPSPLPCTSRSSAWQRASCCGPWEPHDVYLSWQGNLLRKMLLNNYLQNKKSSSK
GEIVDAAGGDTLLTVLVLPHDRSVTASHLFGSSCVGQDQDWSAIAAVQCRLDREGATKLV
ADLIMNTKNEKIFQESILLAIRLLDGGNTEIQKSFYNLMTSDKKSEKFFKVLHDRMKKAQ
QETKSTVSVNMSDIGNKPREDKDEPDPGLKGMGSRFPWCGQRAVLLDSPMLMRLGFPLGR
GETFVMPGTPSRYPMAIGFRKGHDAGEQGQNNEMGVTVLIMEPILRFLQLLCENHNRDLQ
NFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEYNVALITQTLETLTEYCQ
GPCHENQSCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHD
SENDGEKLTCPSCAGAFQVDVIKKAYLQEEECENAEVSPREVGHNIYILALQLSLNNKQL
TQMLKSTAPVQEEEEDPLAYYEKHTSQIEARPIVRLDRSMEQIIFPVPGICEFLTKETKY
RLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQKKLRSMPLMYWFSRRMTLWGSISFNLAV
FINIIIAFFYPYVEATSMGVLDSPLISLLFWILICFSIMALFTKRYGVRPLLVALILRSI
YYLGIGLTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMIMDVEFLYHVGYILTSVLG
LFVHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKD
DFILEVDRLPDNKPKGDPLGMQRNMETFMESCSGDKISCSAVPTALEDIDQWERACDTLL
MCIVTVLNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDT
FADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKYEHNMWNYLYFIVLVRVKN
KTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRNLQDKLNSTMKLVSHL
TSQLNELKEQMTEQRKRRQRMGFV
Download sequence
Identical sequences A0A093HD50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]