SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093HK58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HK58
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-114
Family Capz alpha-1 subunit 0.00000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093HK58
Sequence length 273
Comment (tr|A0A093HK58|A0A093HK58_STRCA) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:KFV79810.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_09307 OC=Struthio.
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLSNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQ
VLITEHGDLGNGRFLDPRNKLSFKFDHLRKEASDPQPEDTEAALKSWRDACDSALRAYVK
DHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLK
IQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDT
TFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A093HK58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]