SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093IA34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093IA34
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 3.27e-29
Family Arp2/3 complex 16 kDa subunit ARPC5 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093IA34
Sequence length 80
Comment (tr|A0A093IA34|A0A093IA34_EURHL) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_05204 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
QEQAQGTMLKVLTSFKSSEIEQAVNSLDRNGVDLLMKYIYKGFEKPTENSSTILLQWHEK
ALAAGGLGSIVRVLTARKTV
Download sequence
Identical sequences A0A093IA34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]