SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093IL39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093IL39
Domain Number 1 Region: 47-266
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 2.62e-30
Family Bactericidal permeability-increasing protein, BPI 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093IL39
Sequence length 266
Comment (tr|A0A093IL39|A0A093IL39_EURHL) BPI fold-containing family B member 4 {ECO:0000313|EMBL:KFW02373.1} KW=Complete proteome; Reference proteome OX=54383 OS=Eurypyga helias (Sunbittern). GN=N326_04375 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Eurypygidae; Eurypyga.
Sequence
LCPVVDIVVNLVNIQLLATLNAVIPVGTAGTIHYQLASLPFTSGLFLGLDLDGAVKQVGG
SIIPHDSSPSALPPLLDKLLVLGLRQSFLNAVLSLLIQIPPQTFTCTPEVFSGASRLQEA
ITTLALDGCSSCRGIGPLSIKLMLSGNPLILLEENKATVELSVMIQLFINRLEGPILNLL
LLKADLGLNVRVSIAGGRLVLGLSLGSTSLSLESSDVGISNIANLTPHCSSLLAETLLPL
INGALGIGIPLPNVLGIPLIKVEIQI
Download sequence
Identical sequences A0A093IL39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]