SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093ISA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093ISA6
Domain Number 1 Region: 51-101
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000114
Family Elafin-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093ISA6
Sequence length 215
Comment (tr|A0A093ISA6|A0A093ISA6_FULGA) WAP four-disulfide core domain protein 1 {ECO:0000313|EMBL:KFW01654.1} KW=Complete proteome; Reference proteome OX=30455 OS=Fulmarus glacialis (Northern fulmar). GN=N327_11272 OC=Fulmarus.
Sequence
EMHFCKKIFTAALCVLVLLPDSGCAKNLWKRALHLKMTEKYDDYEYPLHSHSSHYQKNDR
CPPPPQTLPDRACEVPSCRSDSECERHKRCCYNGCIYACLESVQPPPVLDWLVQPKPRWL
GGNGWLLDGPEEVLQAEACSTTEDGDEPLHCPTGYECHIINPGNTAEGIPNRGQCIKLRG
NPDGRNLRHKYYKEYFGSNSNNVVGYVKNQQKHLG
Download sequence
Identical sequences A0A093ISA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]