SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093NR39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093NR39
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.08e-20
Family ERP29 N domain-like 0.0000142
Further Details:      
 
Domain Number 2 Region: 107-189
Classification Level Classification E-value
Superfamily ERP29 C domain-like 4.71e-18
Family ERP29 C domain-like 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093NR39
Sequence length 189
Comment (tr|A0A093NR39|A0A093NR39_PYGAD) Uncharacterized protein {ECO:0000313|EMBL:KFW62602.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_06351 OC=Pygoscelis.
Sequence
VIPKHKFVLVKFDTQYPYGEKQDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTELGEKY
KLDKEKFPIFYLFRDGDFDNPLPYSGQIKARAIQRWLKSNGIYLGMPGCLKEYDMLASKF
VSTTEKSERQSLLKKGQESLEKTKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKLI
EKNKMSDGK
Download sequence
Identical sequences A0A093NR39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]