SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093P2T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093P2T4
Domain Number 1 Region: 176-353
Classification Level Classification E-value
Superfamily MIR domain 6.89e-51
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1040-1165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-17
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 3942-4020
Classification Level Classification E-value
Superfamily EF-hand 0.000000000271
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 4 Region: 618-752
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000174
Family SPRY domain 0.058
Further Details:      
 
Domain Number 5 Region: 60-141
Classification Level Classification E-value
Superfamily MIR domain 0.00000562
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 1371-1492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000115
Family SPRY domain 0.022
Further Details:      
 
Domain Number 7 Region: 381-507
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000124
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Domain Number 8 Region: 2105-2171
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000693
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093P2T4
Sequence length 4899
Comment (tr|A0A093P2T4|A0A093P2T4_PYGAD) Ryanodine receptor 2 {ECO:0000313|EMBL:KFW70696.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_13961 OC=Pygoscelis.
Sequence
NVPPDLSICTFVLEQSLSVRALQEMLANTEEKAEGRAQELSISLLFIFQSAQGGGHRTLL
YGHAILLRHSYSGMYLCCLSTSRSSMDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEK
VRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEVAQGYLIGGDVL
RLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSIHARSLWRLETLRVAWSGSHIRWGQP
FRLRHITTGKYLSLLDDKSLLLTDKEKADVKSTAFCFRSSKEKLDIGTRKEVDGMGAPEI
KYGDSICFIQHVDTGLWLTYQSADAKSVRMGSVQRKAIMHHEGHMDDGLTLSRSQNEESR
TARVIRSTVFLFNRFIRGLDALSKKVKSSTVDLPIESVSLSLQDLIGYFHPPDEHLEHED
KQNRLRALKNRQNLFQEEGMINLVLECIDRLNVYSSAAHFADVAGKEAGEAWKSILNSLY
KLLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHI
KSIICLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSS
MRPNIFLGISEGSAQYRKWYYELMVDHLEPFVTAESTHLRVGWASTEGYSPYPGGGAEWG
GNGVGDDLYSYGFDGLHLWSGCVARTVNSPNQHLLRTDDVISCCLDLSAPSISFRINGQP
VQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCFEAVLPKEKLKV
EHSREYKQDRSYTRDLLGPTISLSQAAFTPVPVDTSQIVLPPHLERIREKLAENIHELWV
MNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIAD
EHAEEKVKKMKLPKNYQLLSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQ
GWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHATR
LDVCSGIMEKFRIFRTEKTYAVKAGKWYFEFEAVTAGDMRVGWTRPGCLPDQELGSDEEA
FVFDGFKAQRWHQGNEHFGRSWLAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKD
FEVGDGFLPVCSLGPSQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITIWLSKR
LPQFLPVPQNHEHIEVMRIDGTIDSCPCLKVTQKSFGSQNSKTEVMFFRLSMPIECAEVF
SRSAAGGLPGSGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRTEREKDATKPELNNHK
DYVQEKPSRLKQRFMLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFP
GQEPANVWVGWITSDFHQYDTSFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESM
SPGQGRNNNGLEIGCLVDAASGLLTFTANGKELGTYYQVEPSTKLFPAVFAQATSPNVFQ
FELGRIKNVMPLSAGLFKSEHKNPVSQCPPRLHVQFLTHVLWSRVPNHFLKVDVSRISER
QGWMIQCLNPLQFMALHIPEENRTIDILELTEQEELLKFHYHTLRLYSAVCALGNNRVAH
AMCSHVDESQLLYAIENKYMPGLLRAGYYDLLIDIHLNTYATARLMMNNEFIVPMTDETK
SITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSVSSECFQFSPEFPLEILKAKTIEM
LTEAVQEGSLHVRDPVGGSTEFLFVPLIKLFYTLLIMGIFHNGDLKHILQLIEPRVFKEA
ISQEDEVDFSEKELSSDELKSEEGEEESRGEQVPKEGLLQMKLPEPVKLQMCHLLQYLCD
CQIRHRIEAIVAFSDDFVAKLQENQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINM
LLNFKDDKNDCPCPEEIRDQLLDFHEDLMTHCGIELDEDGTLDGNSDLTIRGRLLYLMEK
VTYLKKKQAEKPVDDDAKTSSTLQQLISDTMVRWAQESVIEDPELVRAMFVLLHRQYDGI
GGLVRALPKTYTINSVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVF
YQHPNLMRALGMHETVMEVMVNVLGGGESKEIIFPKMVANCCRFLCYFCRISRQNQKAMF
DHLSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQ
SCPLLISKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPAL
RGEGGNGLLAAMEEAIQISEDPTRDGPSPSNGLSKTLEMEEQEDDTIHMGNAIMTFYAAL
IDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLEDLVGVISIPFHMPTIAKDGTVVEPD
MSAGFCPDHKAAMVLFLDRVYGIEDQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALA
LNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEECLLS
ICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASE
EELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVNMMEKQSSM
DSDGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMEKFANGWTYGETYSESAKVQP
LMKQYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQISV
DTAHGYTPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELEAKGGGNHPLLVPYD
TLTAKEKAKDREKAQDILKFLQINGYVVSRGLKDLELDTPSIEKRFAYSFLQQLIRYVDE
AHQYILEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLSSGGH
ASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKM
ALRAFLDNAAEDLEKTMENLKQGQFTHSRNQPKGITQIINYTTVALLPVLSSLFEHIGQH
QFGEDLILEDVQVSCYRILASLYALGTSKSIYVERQRSALGECLAAFSGAFPVAFLETHL
NKHNIYSIYNTKNARDRAVLNLPTSVEEVCPNIPSLVKLMEEIVELAQSGIRYTQMPHIM
EVILPMLCSYMSHWWEHGPENNPDKAEMCCTALTSEHMNTLLGNILKIIYNNLGIDEGAW
MKRLAVFSQPIISKAKPQLLKTHFLPLMDKLKKKAAVVVSDEEHLRAEGRGDMSEAELLI
LDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKRE
EQNFVVQNEINNMSFLISDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLP
IGLNICAPGDQELIALAKNRFSMKDTEDEVRDIIRNNLHLQGKLEDPAIRWQMALYKDLP
NRTEDTSDPEKTVERVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAP
LYNLPRHRAVNLFLQGYDKSWIETEEHYFEDKLIEDLAKPGEEPPEEDESLKRVDPLHQL
ILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQ
QARLHDRGAAEMVLQTISASKGEMGPMVAATLKLGIAILNGGNSTVQQKMLDYLKDKKDV
GFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVMQDDEFTCDLFRFLQLLC
EGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFS
KAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIEL
LKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLT
SSDAFKEYDPDGKGIISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRF
HEPAKDIGFNVAVLLTNLSEHMPHDTRLQTFLELSESVLNYFQPFLGRIEIMGSAKRIER
VYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS
ESDLNERSANKEENEKDKPEEQDPRTGFFSLVTMKSALVALKYNLMTLMKMLSMKSLKKQ
MKKVKKMTMKDMVMALFSSYWSILMGLLHFGCSVVRGFFRIICSLLLGGSLVEGAKKIKV
AELLANMPDPTQDEVRGEGEEGERKPTEAALPTEDLTDLRTLSDESDLLSDIFGLDLKRE
GGQYKLIPHNPNAGLSDLLSSPSLAPMPEVQEKIQVKEDEKEEKEETKSEPEKAEGEDGE
KEEKAKEDKGKQKLRQLHTHRYGEPEVQESAFWKKIIAYQQKLLNYFARNFYNMRMLALF
VAFAINFILLFYKVSTSAVTEEKEVPVVSAGESTKLNSLESDNQRVIAVHYVLEESSGYM
EPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKG
QWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKP
KKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAM
GFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDMPDMKCDD
MLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIID
AFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINK
DETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences A0A093P2T4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]