SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093PTB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093PTB1
Domain Number 1 Region: 182-373
Classification Level Classification E-value
Superfamily MIR domain 2.44e-61
Family MIR domain 0.0000000855
Further Details:      
 
Domain Number 2 Region: 375-540
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.96e-56
Family IP3 receptor type 1 binding core, domain 2 0.000000227
Further Details:      
 
Domain Number 3 Region: 1053-1199
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.01e-31
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 52-165
Classification Level Classification E-value
Superfamily MIR domain 5.49e-21
Family MIR domain 0.017
Further Details:      
 
Domain Number 5 Region: 1151-1283,1337-1606,1873-2052
Classification Level Classification E-value
Superfamily ARM repeat 0.000000204
Family HspBP1 domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093PTB1
Sequence length 2658
Comment (tr|A0A093PTB1|A0A093PTB1_9PASS) Inositol 1,4,5-trisphosphate receptor type 2 {ECO:0000313|EMBL:KFW75337.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_00438 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
DCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEI
VKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIQPFWKLRSEGD
NVVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKFSSYRDDVL
KGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRG
GAGQWNSLFRFKHLATGNYLAAEVRMCNVCNLPGDLPASKKKRQAGEKIMYTLVSVPHGN
DIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQ
TKEDKEAFAIVSVPLSEVRDLDFANDANKVLASTVKKLENGTITQNERRFVTKLLEDLIF
FVADVPNNGQEVLDVIVTKPNRERQKLMREQNILAQIFGILKAPFKDKGEGSMLRLEDLG
DQRYAPYKYVLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHNN
RKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGNA
DILIQTKLVSTQTDNPLECPVISDDVDEEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKA
DLEVLTYYRNLWCLSNMPDCGLKFLLRSQSMSKLKVLQTKVQKHFVGLFSGQNGCRCLML
TKDVSVAEHRTIFSFPFFCALHCRYDSFTDSSRNEMKTKFALTMEFVEEYLKEVVNQPFP
FGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQVPISSYFERLSKFQ
DGGNNVMRTIHGVGEMMTQMVLSRGSVFPISTPDIQPSIHPSKQASPADSEDVIVMDTKL
KIIEILQFILSVRLDYRISYMLSIYKREFGENNENADCSTTSPPDTPGTTSAIVPDIDEI
AAQAETMFAGRKEKNAVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALHLLFKHFSQRAEV
LQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYESGEVGDNQTKGGE
EPLEVSLKPLLIKSNNYNIVKEILIRLSKLCVQNKKGRNQQQRLLKNMGAHLVVLDLLQI
PYEKSDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKNLNLFLTPGLLEAETMRHIFMNNY
LLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKYVKKCQDMVMTELINGGEDV
LIFYNDRASFPVLLQMMCSERDRADESGPLAYHVTLVELLAACTEGKNVYTEIKCNSLLP
LDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYASNHIWKLFENFLVDMARVC
NTTTDRKHADTSLEKYVTEPVMNIVSGFFNSPFSDNSTSLQTHQPVFIQLLQSAFRIYNC
TWPNPTQKASVESCIKTLAEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRMSA
RSGPRFKEALGGPAWDYRNIIEKLQDVVSSLEQQFTPMMQAEFSVLVDVLHSPELLFPEG
SDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLDKKTNFAEEVSTISLRYLSQ
PFLPGTEQPILMKLATTLISSIFIFLLKGNTLRKILLYRYFKGEYGSGMNGPLSASYSKT
AQVGGGFSGQDSDKSGVTMFDIQCLLDKEGASELVIDVIVNTRNDRIFSEGILLGIALLE
GGNTQTQYSTYQQLKEQKKSEKFFKVLYDRMKAAQQEIRSTVTVNTIDLGSKKKEDDSDL
TISVPKKRVKDSTLHLKEGMKGQLTEASSATSKAYSVYRREMDPEIDLMGSGTDAANAEE
KSTEEAIMSPAIAIMQPILRFLQLLCENHNRELQNFLRHQNNKTNYNLVCETLQFLDCIC
GSTTGGLGLLGLYINERNVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALIL
NDINPLGKYCMDLVLQLKNNASKLLLAIMESRQDSENAERILFNMRPRELVDVMKNAYNQ
GLDCDHEEENGDDGISPKDVGHNIYILAHQLARHNKTLQQMLKPGSDPDEGDEALRFYAK
HTAQIEIVRHDRTMEQIVFPVPNICEFLTRESKSRVFNTTERDEQGSKVNDFFQQTEDLY
NEMKWQKKIRNNQALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGKWSTLSP
LFSVLLWIAVAFCTAMLFFISKPVGIRPFLVSVILRSIYTIGLGPTLILLGAANLCNKIV
FLVSFVGNRGTFTRGYRAVIMDMAFLYHVAYVLVCMLGLCVHEFFYSFLLFDLVYREETL
LNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFIMEVDRLKIRTPAAGISEVP
TTTLTSMMGACPKENCSTSIPVINPGEEEEDGIERTCDTLLMCIVTVLNQGLRNGGGVGD
VLRKPSKDEPLFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTC
FICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKN
LDWFPRMRAMSLVSNEGDSEQNEIRNLQERLESTMSLVKQLSSQLAELKEQMTEQRKNKQ
RLGFLGSNTPHVNHHMPP
Download sequence
Identical sequences A0A093PTB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]